(data stored in ACNUC7421 zone)

EMBL: CP000031.PE255

CP000031.PE255       Location/Qualifiers
FT   CDS             complement(283122..284063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0265"
FT                   /product="auxin efflux carrier family protein"
FT                   /note="identified by similarity to GB:AAA99820.1; match to
FT                   protein family HMM PF03547"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93585"
FT                   /db_xref="GOA:Q5LX43"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX43"
FT                   /protein_id="AAV93585.1"
FT                   /translation="MSQILTITFPIYAALAVGFLVVRQGWFSSADMRVLGRYVMDIALP
FT                   ALLFNAVASRDVAEVFHPGYMLAFAAAGLATVALSYLWFTLTGTEARRRAVAVMGSSCP
FT                   NSGFVGYPVMLLTFPDLAGVILALNMLVENVLIIPACLILTDMARGRGQGGIGQRIAGI
FT                   LWGVLKRPMVIGLLLGLAVSLAGVPVPQTVTRLMQMLAASASALALVVIGGSLAGLSWK
FT                   GSRWHAVQISALKLLLHPALALLAVILVAAIGLPLDPDMGTALILSAAMPMFGIYAVLA
FT                   QELGHEGMASIALLTATTLAFFTLSGLLWWLT"
     MSQILTITFP IYAALAVGFL VVRQGWFSSA DMRVLGRYVM DIALPALLFN AVASRDVAEV        60
     FHPGYMLAFA AAGLATVALS YLWFTLTGTE ARRRAVAVMG SSCPNSGFVG YPVMLLTFPD       120
     LAGVILALNM LVENVLIIPA CLILTDMARG RGQGGIGQRI AGILWGVLKR PMVIGLLLGL       180
     AVSLAGVPVP QTVTRLMQML AASASALALV VIGGSLAGLS WKGSRWHAVQ ISALKLLLHP       240
     ALALLAVILV AAIGLPLDPD MGTALILSAA MPMFGIYAVL AQELGHEGMA SIALLTATTL       300
     AFFTLSGLLW WLT                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page