(data stored in ACNUC7421 zone)

EMBL: CP000031.PE256

CP000031.PE256       Location/Qualifiers
FT   CDS             complement(284060..284764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0266"
FT                   /product="HD domain protein"
FT                   /note="identified by match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93586"
FT                   /db_xref="GOA:Q5LX61"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX61"
FT                   /protein_id="AAV93586.1"
FT                   /translation="MTTCFCTGARSGPTVAISADLHQALRGIVAQRMATDPAHDLAHLD
FT                   RVWVNVQAIASPGADRDVLLAASYLHDLVNLPKNAPDRHTASRRSADEAAPILRDLGFD
FT                   EAQIAATGHAIAAHSFSAGISPESEEARILRDADRLDALGAIGIARNFSVSGSLGRALY
FT                   DPADPFCERRTPDDALYSLDHWRVKLLSLPQGMLTDKGRALAEARIALMLRFLDDFAAE
FT                   IGTPLPEGWTRG"
     MTTCFCTGAR SGPTVAISAD LHQALRGIVA QRMATDPAHD LAHLDRVWVN VQAIASPGAD        60
     RDVLLAASYL HDLVNLPKNA PDRHTASRRS ADEAAPILRD LGFDEAQIAA TGHAIAAHSF       120
     SAGISPESEE ARILRDADRL DALGAIGIAR NFSVSGSLGR ALYDPADPFC ERRTPDDALY       180
     SLDHWRVKLL SLPQGMLTDK GRALAEARIA LMLRFLDDFA AEIGTPLPEG WTRG             234
//

If you have problems or comments...

PBIL Back to PBIL home page