(data stored in ACNUC9435 zone)

EMBL: CP000031.PE259

CP000031.PE259       Location/Qualifiers
FT   CDS             286691..287305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0269"
FT                   /product="negative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF04299"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93589"
FT                   /db_xref="GOA:Q5LX58"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX58"
FT                   /protein_id="AAV93589.1"
FT                   /translation="MHPNPAFRGESVARNLEFARDRGFGVLAVAVDGAPLISHVPFLVS
FT                   GDGSEVELHLVRSNPIVQALKSPLPARIAVSGPDGYISPDWYGVADLVPTWNYVAVHLA
FT                   GELDLRPESELPGLLDRLSARFEKQLLPKPAWTRAKMTPGAFDRMLRMIVPCRMRVSDV
FT                   QGTWKLGQNKPEAARMGAAEGVAASTIGTELETLAVLMRGA"
     MHPNPAFRGE SVARNLEFAR DRGFGVLAVA VDGAPLISHV PFLVSGDGSE VELHLVRSNP        60
     IVQALKSPLP ARIAVSGPDG YISPDWYGVA DLVPTWNYVA VHLAGELDLR PESELPGLLD       120
     RLSARFEKQL LPKPAWTRAK MTPGAFDRML RMIVPCRMRV SDVQGTWKLG QNKPEAARMG       180
     AAEGVAASTI GTELETLAVL MRGA                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page