(data stored in ACNUC9435 zone)

EMBL: CP000031.PE265

CP000031.PE265       Location/Qualifiers
FT   CDS             291467..292033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0275"
FT                   /product="cytochrome b, putative"
FT                   /note="identified by match to protein family HMM PF01292"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93595"
FT                   /db_xref="GOA:Q5LX69"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX69"
FT                   /protein_id="AAV93595.1"
FT                   /translation="MAGTPGGREGAREIRVWDPLVRLTHWGVALGVLVNSALTDPDGAL
FT                   HEQVGYGVLALVVLRLLWCIVGPKPARFSAFPPSPAAALGHLRAMLRGERKVHLSHNPL
FT                   GALMVYNLWLTLLALSATGIMMGTVTFFGVDWVEELHEAAFGWLMFSVALHVGGVLFDQ
FT                   WRTGVPLARAMVTGRKRIQAERLDG"
     MAGTPGGREG AREIRVWDPL VRLTHWGVAL GVLVNSALTD PDGALHEQVG YGVLALVVLR        60
     LLWCIVGPKP ARFSAFPPSP AAALGHLRAM LRGERKVHLS HNPLGALMVY NLWLTLLALS       120
     ATGIMMGTVT FFGVDWVEEL HEAAFGWLMF SVALHVGGVL FDQWRTGVPL ARAMVTGRKR       180
     IQAERLDG                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page