(data stored in ACNUC7421 zone)

EMBL: CP000031.PE266

CP000031.PE266       Location/Qualifiers
FT   CDS             292054..292551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0276"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93596"
FT                   /db_xref="GOA:Q5LX68"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX68"
FT                   /protein_id="AAV93596.1"
FT                   /translation="MRPGDADERRAAILAWMIVLQALCALFFIGDVLADLRAGNDDTGT
FT                   HLWLEGSVALVLCIGLGVLMYELRQLLMRMERVTTTLRAARGEMAEVIEGFFADWGLTP
FT                   AERDVALMILKGLDNDSIATVRGRAAGTVRAQSAAIYAKAGVDGRTQFLSLFMEELLAD
FT                   PD"
     MRPGDADERR AAILAWMIVL QALCALFFIG DVLADLRAGN DDTGTHLWLE GSVALVLCIG        60
     LGVLMYELRQ LLMRMERVTT TLRAARGEMA EVIEGFFADW GLTPAERDVA LMILKGLDND       120
     SIATVRGRAA GTVRAQSAAI YAKAGVDGRT QFLSLFMEEL LADPD                       165
//

If you have problems or comments...

PBIL Back to PBIL home page