(data stored in ACNUC9435 zone)

EMBL: CP000031.PE270

CP000031.PE270       Location/Qualifiers
FT   CDS             complement(295450..295923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0281"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC93558.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93599"
FT                   /db_xref="GOA:Q5LX64"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX64"
FT                   /protein_id="AAV93599.1"
FT                   /translation="MNTLKSFIGGVALSLTLAGSAMAAGVDLNASSTGLALQGYDPVAY
FT                   FTVGEATEGDWKITAVYDDATYRFANAENKATFEANPEAYLPAYGGYCAFGAAMGFKFD
FT                   GDPDNWKIVDDKLYLNLSDEIQAKWEEDVPGFIVKANANWTDIADKAPAELQN"
     MNTLKSFIGG VALSLTLAGS AMAAGVDLNA SSTGLALQGY DPVAYFTVGE ATEGDWKITA        60
     VYDDATYRFA NAENKATFEA NPEAYLPAYG GYCAFGAAMG FKFDGDPDNW KIVDDKLYLN       120
     LSDEIQAKWE EDVPGFIVKA NANWTDIADK APAELQN                                157
//

If you have problems or comments...

PBIL Back to PBIL home page