(data stored in ACNUC9435 zone)

EMBL: CP000031.PE273

CP000031.PE273       Location/Qualifiers
FT   CDS             complement(296987..298276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0284"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /EC_number="3.5.2.3"
FT                   /note="identified by similarity to SP:P46538; match to
FT                   protein family HMM PF01979; match to protein family HMM
FT                   TIGR00857"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93602"
FT                   /db_xref="GOA:Q5LX78"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX78"
FT                   /protein_id="AAV93602.1"
FT                   /translation="MSNILFTNARLIDPEAGTDRIGWLRVTGGRIVATGEDSPQGLEEP
FT                   PAETLDCGGKCLAPGIVDIGVKVGEPGERHKESYKSAGQAAAAGGVTTIITRPDTNPAI
FT                   DTPEALEFVTRRAQADTPVNVLPMAALTKGRQGREMTEIGFLLDAGAVAFTDCDHVVTN
FT                   TKVFSRALTYAKSCGALVIAHPQDPGLSEGAAATSGKFAALYGLPAVSPMAERMGLDRD
FT                   IALLEMTGAKYHADQITTARALPALERAKKNGLDITAGTSIHHLTLNELDVSGYRTFFK
FT                   VKPPLRSEDDRQAVIEAVRTGLIDTISSMHTPQDEESKRLPFEEAASGAVALETLLPAA
FT                   LRLYHAGQLDLPTLFRAMALNPARRLGLASGRLGAGAPADLVLFDPDVPFVLDRFTLKS
FT                   KSQNTPFDGQRMQGRVLATYVAGQAVYRRD"
     MSNILFTNAR LIDPEAGTDR IGWLRVTGGR IVATGEDSPQ GLEEPPAETL DCGGKCLAPG        60
     IVDIGVKVGE PGERHKESYK SAGQAAAAGG VTTIITRPDT NPAIDTPEAL EFVTRRAQAD       120
     TPVNVLPMAA LTKGRQGREM TEIGFLLDAG AVAFTDCDHV VTNTKVFSRA LTYAKSCGAL       180
     VIAHPQDPGL SEGAAATSGK FAALYGLPAV SPMAERMGLD RDIALLEMTG AKYHADQITT       240
     ARALPALERA KKNGLDITAG TSIHHLTLNE LDVSGYRTFF KVKPPLRSED DRQAVIEAVR       300
     TGLIDTISSM HTPQDEESKR LPFEEAASGA VALETLLPAA LRLYHAGQLD LPTLFRAMAL       360
     NPARRLGLAS GRLGAGAPAD LVLFDPDVPF VLDRFTLKSK SQNTPFDGQR MQGRVLATYV       420
     AGQAVYRRD                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page