(data stored in ACNUC9435 zone)

EMBL: CP000031.PE274

CP000031.PE274       Location/Qualifiers
FT   CDS             complement(298273..298659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0285"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93603"
FT                   /db_xref="GOA:Q5LX77"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX77"
FT                   /protein_id="AAV93603.1"
FT                   /translation="MADPVIRFVADRQAYLRNHTWMAAIAMGGAMAVLWALGNPYIWTG
FT                   APAGLAAIALRGWYLASEELAVVWEISEDTLSGPGPRVPLSQIEIVRTMGSYVQVITKG
FT                   GDKHLIKYQADPAATKAAIERAMT"
     MADPVIRFVA DRQAYLRNHT WMAAIAMGGA MAVLWALGNP YIWTGAPAGL AAIALRGWYL        60
     ASEELAVVWE ISEDTLSGPG PRVPLSQIEI VRTMGSYVQV ITKGGDKHLI KYQADPAATK       120
     AAIERAMT                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page