(data stored in ACNUC7421 zone)

EMBL: CP000031.PE279

CP000031.PE279       Location/Qualifiers
FT   CDS             302227..302847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0290"
FT                   /product="transmembrane amino acid efflux protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93608"
FT                   /db_xref="GOA:Q5LX72"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX72"
FT                   /protein_id="AAV93608.1"
FT                   /translation="MIDPVTLLTFVPAALALNLTPGADMMFCLGQGLRAGPRAGWAASA
FT                   GISAGGMVHVSIAGLGLGAAVQAMPWLFDVIRWVGVAYLLWLAWGALRQEFGTSEAPIR
FT                   PARRAFRDGMLVNLTNPKVILFVLAFIPQFIDPAAGPILAQFLVFGVVIAIGGFIVNGM
FT                   VGQFAGGLGRRLTGDPRLGRVLSRLTAGIFAALALRLALLERT"
     MIDPVTLLTF VPAALALNLT PGADMMFCLG QGLRAGPRAG WAASAGISAG GMVHVSIAGL        60
     GLGAAVQAMP WLFDVIRWVG VAYLLWLAWG ALRQEFGTSE APIRPARRAF RDGMLVNLTN       120
     PKVILFVLAF IPQFIDPAAG PILAQFLVFG VVIAIGGFIV NGMVGQFAGG LGRRLTGDPR       180
     LGRVLSRLTA GIFAALALRL ALLERT                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page