(data stored in ACNUC9435 zone)

EMBL: CP000031.PE28

CP000031.PE28        Location/Qualifiers
FT   CDS             27605..29437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0028"
FT                   /product="ABC transporter, transmembrane ATP-binding
FT                   protein"
FT                   /note="identified by similarity to GB:BAB70471.1; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93359"
FT                   /db_xref="GOA:Q5LWH3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWH3"
FT                   /protein_id="AAV93359.1"
FT                   /translation="MRFADLIDPFRDTDTPPPQRLGAFIRWALSGAWPVLFVAALFSAL
FT                   AGMFEAITAWILGQVVDRAVELGPEGFFEGTNLATILVAVGFFVLIRPVAFGLSAFSNN
FT                   YIVMPNIPPLVLAKLNRWTLGQSVGFFDDDFAGRIAQKQMQTASALSSVVSETISAIVF
FT                   ALASLIGSLALLGSIHPLVMLPFAVWLCGYFLLIRWYLPRVRKRSAARAGARAMVSGQV
FT                   VDTITNIKTVKLFAHAEAEDVTARNAMADLRERSLDFGWLSASFRFFLMLLAGVLPVIL
FT                   LGSALILWRAGDASAGDVVVAGSVSIRIAQMSGWVSFTLMSLYANLGEVQNGMNSLARA
FT                   ERIEDVADARPLVAGAGKIDFEDVGFAYGRKSGGVDALSLTVAPGEKLGIVGASGAGKS
FT                   TLVSLLLRLYEAENGQIRIDGQDITTVTQDSLRRQIGLVTQETAMFNRSARENILYGRP
FT                   NASEAELIAAAQKAEAHDFILDLADAKGRTGYDAHLGERGVKLSGGQRQRIALARAILK
FT                   DAPILVLDEATSALDSEVEASIQTALHRVMEGKTVLAIAHRLSTLSEMDRIVVLDRGRI
FT                   VESGTHEALLARDGLYARFWHRQSGGFIRTQAAE"
     MRFADLIDPF RDTDTPPPQR LGAFIRWALS GAWPVLFVAA LFSALAGMFE AITAWILGQV        60
     VDRAVELGPE GFFEGTNLAT ILVAVGFFVL IRPVAFGLSA FSNNYIVMPN IPPLVLAKLN       120
     RWTLGQSVGF FDDDFAGRIA QKQMQTASAL SSVVSETISA IVFALASLIG SLALLGSIHP       180
     LVMLPFAVWL CGYFLLIRWY LPRVRKRSAA RAGARAMVSG QVVDTITNIK TVKLFAHAEA       240
     EDVTARNAMA DLRERSLDFG WLSASFRFFL MLLAGVLPVI LLGSALILWR AGDASAGDVV       300
     VAGSVSIRIA QMSGWVSFTL MSLYANLGEV QNGMNSLARA ERIEDVADAR PLVAGAGKID       360
     FEDVGFAYGR KSGGVDALSL TVAPGEKLGI VGASGAGKST LVSLLLRLYE AENGQIRIDG       420
     QDITTVTQDS LRRQIGLVTQ ETAMFNRSAR ENILYGRPNA SEAELIAAAQ KAEAHDFILD       480
     LADAKGRTGY DAHLGERGVK LSGGQRQRIA LARAILKDAP ILVLDEATSA LDSEVEASIQ       540
     TALHRVMEGK TVLAIAHRLS TLSEMDRIVV LDRGRIVESG THEALLARDG LYARFWHRQS       600
     GGFIRTQAAE                                                              610
//

If you have problems or comments...

PBIL Back to PBIL home page