(data stored in ACNUC9435 zone)

EMBL: CP000031.PE284

CP000031.PE284       Location/Qualifiers
FT   CDS             complement(308787..309605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0295"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC46756.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93613"
FT                   /db_xref="GOA:Q5LX85"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX85"
FT                   /protein_id="AAV93613.1"
FT                   /translation="MGMSTRFPMLALAALLSLPLAAPAPAAGLDDLVQIEILDGGLTPS
FT                   GTYLGAIRMTLSEGWKTYWRAPGEAGIPPSFDWRGSRNLGELSITWPAPEVFEQSGLRS
FT                   IGYTDQMVLPIEITPKDANRPVRLRGEMEFGVCKDICVPGNLDFDHTLDASAPRNPAIV
FT                   AALARRPYSAAEAGVTSATCRISPSQGGMRIEARIAMPSAGGSELAVFEPGDPALWAGE
FT                   AQTRRQGNTLIASSEILNDGGTAFALDRSRIRITVLGAKRAVDIRGCLPG"
     MGMSTRFPML ALAALLSLPL AAPAPAAGLD DLVQIEILDG GLTPSGTYLG AIRMTLSEGW        60
     KTYWRAPGEA GIPPSFDWRG SRNLGELSIT WPAPEVFEQS GLRSIGYTDQ MVLPIEITPK       120
     DANRPVRLRG EMEFGVCKDI CVPGNLDFDH TLDASAPRNP AIVAALARRP YSAAEAGVTS       180
     ATCRISPSQG GMRIEARIAM PSAGGSELAV FEPGDPALWA GEAQTRRQGN TLIASSEILN       240
     DGGTAFALDR SRIRITVLGA KRAVDIRGCL PG                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page