(data stored in ACNUC7421 zone)

EMBL: CP000031.PE287

CP000031.PE287       Location/Qualifiers
FT   CDS             311525..313228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0298"
FT                   /product="acyl-CoA dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93616"
FT                   /db_xref="GOA:Q5LX82"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX82"
FT                   /protein_id="AAV93616.1"
FT                   /translation="MPYRSPVTDYTFLLSHVVGYDRVSGTEKYAEAGADMVSAILTEAG
FT                   RMCDEVMAPLQRGGDLNPARLENGALRSSPGFAEGWKAIAEGGWIGMSGSPEHGGMGLP
FT                   MAVTTAVNDMMSGACLSLQLAPLMSQGQIEALEHHASDAIKALYLPKLISGEWSGTMNL
FT                   TEPQAGSDVGALSSKAEPNGDGTYAVTGQKIFISWGDNDFCDNVCHLVLARLPDGVPGT
FT                   KGISLFLVPRNLPDENGNAGVANSLKVVSLEHKMGLHGSPTCVMQYDGATGWLVGEEHG
FT                   GMAAMFTMMNNARLGVGGQGVGVAEAAWQHAMAYAMERKQGKSASGTIADHADVRRMLT
FT                   SMKADVFAARAILAACAVAIDMGNATGSAEWKARAAFLTPIAKAFGTDTGIAVSETGVQ
FT                   VHGGMGFIEETGAAQFYRDVRVTAIYEGTNGIQAMDLVARKMMDGGEAAAKLLDEIEDH
FT                   AERARGRLPELAGPVWEATETLREATEWMVAQGELNDRFAGAVPFLRAFARVLGGHFHL
FT                   IAALADPGGPREKLARYYINALLPEHAGLLEQAQGGCADLYAISLEELSA"
     MPYRSPVTDY TFLLSHVVGY DRVSGTEKYA EAGADMVSAI LTEAGRMCDE VMAPLQRGGD        60
     LNPARLENGA LRSSPGFAEG WKAIAEGGWI GMSGSPEHGG MGLPMAVTTA VNDMMSGACL       120
     SLQLAPLMSQ GQIEALEHHA SDAIKALYLP KLISGEWSGT MNLTEPQAGS DVGALSSKAE       180
     PNGDGTYAVT GQKIFISWGD NDFCDNVCHL VLARLPDGVP GTKGISLFLV PRNLPDENGN       240
     AGVANSLKVV SLEHKMGLHG SPTCVMQYDG ATGWLVGEEH GGMAAMFTMM NNARLGVGGQ       300
     GVGVAEAAWQ HAMAYAMERK QGKSASGTIA DHADVRRMLT SMKADVFAAR AILAACAVAI       360
     DMGNATGSAE WKARAAFLTP IAKAFGTDTG IAVSETGVQV HGGMGFIEET GAAQFYRDVR       420
     VTAIYEGTNG IQAMDLVARK MMDGGEAAAK LLDEIEDHAE RARGRLPELA GPVWEATETL       480
     REATEWMVAQ GELNDRFAGA VPFLRAFARV LGGHFHLIAA LADPGGPREK LARYYINALL       540
     PEHAGLLEQA QGGCADLYAI SLEELSA                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page