(data stored in ACNUC7421 zone)

EMBL: CP000031.PE288

CP000031.PE288       Location/Qualifiers
FT   CDS             313225..314274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0299"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93617"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX81"
FT                   /protein_id="AAV93617.1"
FT                   /translation="MMDRTPGLAMRYPWDEPPAHGSAIEVAEGVLWMRLPLPMKLDHVN
FT                   VYALDDGDGWTVIDTGFSSKKTRAIWQALIDGPLAGKPVRRVVVTHHHPDHMGNAGWFQ
FT                   SELGAELVTTRTAWLFSRMLTLDVQESWPEETLDYYRSAGMAPEVLAKRMAERPFNFAD
FT                   MVYPMPLGFARIKQGDVFRMGGRDWDVHMGNGHAPEHATFWSRDDNLVITGDQILSSIS
FT                   PNIGVYATEPMADPLADWLETCERLAPLARPEHLALGGHKLPFTGLPIRMRQLIDNHHG
FT                   ALKRLRDHLDTPKAASDCFAPLFKRTIGEGEYGLALVEAVAHVNHLYHTGEVTRTRRAD
FT                   GAWLYQRKG"
     MMDRTPGLAM RYPWDEPPAH GSAIEVAEGV LWMRLPLPMK LDHVNVYALD DGDGWTVIDT        60
     GFSSKKTRAI WQALIDGPLA GKPVRRVVVT HHHPDHMGNA GWFQSELGAE LVTTRTAWLF       120
     SRMLTLDVQE SWPEETLDYY RSAGMAPEVL AKRMAERPFN FADMVYPMPL GFARIKQGDV       180
     FRMGGRDWDV HMGNGHAPEH ATFWSRDDNL VITGDQILSS ISPNIGVYAT EPMADPLADW       240
     LETCERLAPL ARPEHLALGG HKLPFTGLPI RMRQLIDNHH GALKRLRDHL DTPKAASDCF       300
     APLFKRTIGE GEYGLALVEA VAHVNHLYHT GEVTRTRRAD GAWLYQRKG                   349
//

If you have problems or comments...

PBIL Back to PBIL home page