(data stored in ACNUC7421 zone)

EMBL: CP000031.PE290

CP000031.PE290       Location/Qualifiers
FT   CDS             314804..316648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0301"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93619"
FT                   /db_xref="GOA:Q5LX79"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX79"
FT                   /protein_id="AAV93619.1"
FT                   /translation="MSHFTHVRNAWSGSWSRRRVFVPLYAALRLLVLALIAPALAGLIN
FT                   LAVSLSDQSALTDQDIARFVLSPLGFAATLAVLSVLLVAEVLSFAVMAATLRSGASNVW
FT                   HAGSAGLALVLRRLRPLLIFAALFVLRVLALAAPFVALAGLIAWWVLVDYDINYYLTFR
FT                   PPSFRLAMAGIAVLVLVLAWLLMLRLSGWALSLHLVIFEGTRPAQAFAESTRRMGTRRG
FT                   ALKIELVLWLLTRLALAAALGALASAALALVPIPQEGALRRALVLVVLVMGLWSLAGLA
FT                   LAATALGALTKLLDRFYDGAAAAAPLSPSRPQGLRGRLIGAALLAALALGAGMWVSDGL
FT                   LTQLTAKDEVSVIGHRGAAGARPENTMAAIVKAIEDGADWVEIDVQETADGEVVVMHDS
FT                   DFMKLAGVPTKIWDATMQDLAEIDIGSWFSPDYAAERAPTLRAVLEAARGKSNVLIELK
FT                   YYGHDVDLENRVIALVEEFGMQDQIATMSLKYPAVQKMRALRPDWRTGVLAATAVGDLA
FT                   GLEGDFVAVSSASLRPSLLRAAHAAGKDVYVWTVNEPLLMSKMISMGVDGLITDEPAMA
FT                   REVLAVRATLNPAERLLLWLTQELGWELNAKAYRDDSP"
     MSHFTHVRNA WSGSWSRRRV FVPLYAALRL LVLALIAPAL AGLINLAVSL SDQSALTDQD        60
     IARFVLSPLG FAATLAVLSV LLVAEVLSFA VMAATLRSGA SNVWHAGSAG LALVLRRLRP       120
     LLIFAALFVL RVLALAAPFV ALAGLIAWWV LVDYDINYYL TFRPPSFRLA MAGIAVLVLV       180
     LAWLLMLRLS GWALSLHLVI FEGTRPAQAF AESTRRMGTR RGALKIELVL WLLTRLALAA       240
     ALGALASAAL ALVPIPQEGA LRRALVLVVL VMGLWSLAGL ALAATALGAL TKLLDRFYDG       300
     AAAAAPLSPS RPQGLRGRLI GAALLAALAL GAGMWVSDGL LTQLTAKDEV SVIGHRGAAG       360
     ARPENTMAAI VKAIEDGADW VEIDVQETAD GEVVVMHDSD FMKLAGVPTK IWDATMQDLA       420
     EIDIGSWFSP DYAAERAPTL RAVLEAARGK SNVLIELKYY GHDVDLENRV IALVEEFGMQ       480
     DQIATMSLKY PAVQKMRALR PDWRTGVLAA TAVGDLAGLE GDFVAVSSAS LRPSLLRAAH       540
     AAGKDVYVWT VNEPLLMSKM ISMGVDGLIT DEPAMAREVL AVRATLNPAE RLLLWLTQEL       600
     GWELNAKAYR DDSP                                                         614
//

If you have problems or comments...

PBIL Back to PBIL home page