(data stored in ACNUC7421 zone)

EMBL: CP000031.PE291

CP000031.PE291       Location/Qualifiers
FT   CDS             316617..317195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0302"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE78911.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93620"
FT                   /db_xref="GOA:Q5LX96"
FT                   /db_xref="InterPro:IPR036444"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX96"
FT                   /protein_id="AAV93620.1"
FT                   /translation="MQRPIAMTARNLLILCLCAGSPAMAQDLTQMLEMPAHRALMAAQQ
FT                   AAPLTPFTTDGCSGGLSAGWTMVGDTFPDFAAAQGNLPPWEACCVIHDRAYHDAGGALT
FT                   PEDSYAARQQADRALQSCVRDTGESHLADLAVRYDTTPEKVRSAYGTIADAMYLAVRFG
FT                   GGPCSGLPWRWGYGYAHCTPFDSTAPARD"
     MQRPIAMTAR NLLILCLCAG SPAMAQDLTQ MLEMPAHRAL MAAQQAAPLT PFTTDGCSGG        60
     LSAGWTMVGD TFPDFAAAQG NLPPWEACCV IHDRAYHDAG GALTPEDSYA ARQQADRALQ       120
     SCVRDTGESH LADLAVRYDT TPEKVRSAYG TIADAMYLAV RFGGGPCSGL PWRWGYGYAH       180
     CTPFDSTAPA RD                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page