(data stored in ACNUC9435 zone)

EMBL: CP000031.PE294

CP000031.PE294       Location/Qualifiers
FT   CDS             complement(318368..319084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0305"
FT                   /product="AzlC family protein"
FT                   /note="identified by match to protein family HMM PF03591"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93623"
FT                   /db_xref="GOA:Q5LX93"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX93"
FT                   /protein_id="AAV93623.1"
FT                   /translation="MSFTTSKSVYWKGFRDGAPFIMVAAPFGTLFGVFATEAGLNLVQV
FT                   MTFTATVFAGAAQFTALQLLLDDTPTLIVLLSALAVNLRVAMYSAALTPYLGAAPLWQR
FT                   AVAAYFTVDQSYALSVVRFETEPDLTVPQRMAYFFGTVTPLAPAWYLATYLGAVLGTRI
FT                   PDSWALDFALPITFLAMIGPMLRTLPHVIAALVAIVTALLTAAVPFNLGLLIAGTAGMM
FT                   AGARAEVILERRSKRT"
     MSFTTSKSVY WKGFRDGAPF IMVAAPFGTL FGVFATEAGL NLVQVMTFTA TVFAGAAQFT        60
     ALQLLLDDTP TLIVLLSALA VNLRVAMYSA ALTPYLGAAP LWQRAVAAYF TVDQSYALSV       120
     VRFETEPDLT VPQRMAYFFG TVTPLAPAWY LATYLGAVLG TRIPDSWALD FALPITFLAM       180
     IGPMLRTLPH VIAALVAIVT ALLTAAVPFN LGLLIAGTAG MMAGARAEVI LERRSKRT         238
//

If you have problems or comments...

PBIL Back to PBIL home page