(data stored in ACNUC9435 zone)

EMBL: CP000031.PE298

CP000031.PE298       Location/Qualifiers
FT   CDS             321739..322539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0309"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAK23994.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93627"
FT                   /db_xref="GOA:Q5LX89"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX89"
FT                   /protein_id="AAV93627.1"
FT                   /translation="MRPFDTIAMVDWSGGNDTGPRPRKDAIWACVAGAEPVYLRNRGLA
FT                   ENWLCDLIETALAAGRRLMLGFDFPFGYPTGFARAVSGSDDPLHIWDWFEARIEDTPKA
FT                   NNRFDLAGAVNRGLGGKGPFWANGLKRDIGGLPRTKRDYHNPFADRRLVERRAPGAFTC
FT                   WQMAGAGAVGGQVMMGLPVLARLRRRFAGQIGVWPFERLDKPVALVEIWPSLTLGKAPE
FT                   GRIKDAWQVERVASDLSGMSLARLGSLLNVTAPEEGWILGVDQG"
     MRPFDTIAMV DWSGGNDTGP RPRKDAIWAC VAGAEPVYLR NRGLAENWLC DLIETALAAG        60
     RRLMLGFDFP FGYPTGFARA VSGSDDPLHI WDWFEARIED TPKANNRFDL AGAVNRGLGG       120
     KGPFWANGLK RDIGGLPRTK RDYHNPFADR RLVERRAPGA FTCWQMAGAG AVGGQVMMGL       180
     PVLARLRRRF AGQIGVWPFE RLDKPVALVE IWPSLTLGKA PEGRIKDAWQ VERVASDLSG       240
     MSLARLGSLL NVTAPEEGWI LGVDQG                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page