(data stored in ACNUC9435 zone)

EMBL: CP000031.PE302

CP000031.PE302       Location/Qualifiers
FT   CDS             complement(325446..325826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0313"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93631"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA3"
FT                   /protein_id="AAV93631.1"
FT                   /translation="MKATLEHANLTVADPKATAAWLNTVFGWETRWEGAAIAGGYTVHV
FT                   GDAGTYLALYAPPKPVPSAETSYDVIGGLNHVGVVVDDIDATEERVRAAGFTPHNHADY
FT                   EPGRRFYFDDDNGIEFEVVSYP"
     MKATLEHANL TVADPKATAA WLNTVFGWET RWEGAAIAGG YTVHVGDAGT YLALYAPPKP        60
     VPSAETSYDV IGGLNHVGVV VDDIDATEER VRAAGFTPHN HADYEPGRRF YFDDDNGIEF       120
     EVVSYP                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page