(data stored in ACNUC7421 zone)

EMBL: CP000031.PE304

CP000031.PE304       Location/Qualifiers
FT   CDS             complement(326374..326682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0315"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAM41091.1; match to
FT                   protein family HMM TIGR02118"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93633"
FT                   /db_xref="GOA:Q5LXA1"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA1"
FT                   /protein_id="AAV93633.1"
FT                   /translation="MPVSLQVAYPTRDDTTFDYDYYLTTHMGLVAEHMGPHIQNTVVTK
FT                   GLAGGPDTPPPFHAIATIVFADQNAMNAAMKASGPVVSDIPNFYNSAPQMLIGEVVG"
     MPVSLQVAYP TRDDTTFDYD YYLTTHMGLV AEHMGPHIQN TVVTKGLAGG PDTPPPFHAI        60
     ATIVFADQNA MNAAMKASGP VVSDIPNFYN SAPQMLIGEV VG                          102
//

If you have problems or comments...

PBIL Back to PBIL home page