(data stored in ACNUC9435 zone)

EMBL: CP000031.PE305

CP000031.PE305       Location/Qualifiers
FT   CDS             326914..328560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0316"
FT                   /product="electrotransfer ubiquinone oxidoreductase family
FT                   protein"
FT                   /note="identified by similarity to SP:Q16134; match to
FT                   protein family HMM PF05187"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93634"
FT                   /db_xref="GOA:Q5LXA0"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA0"
FT                   /protein_id="AAV93634.1"
FT                   /translation="MAEIEREAMEYDVVIVGAGPAGLSAAIRLKQLDADLNVVVLEKGS
FT                   EVGAHILSGAVLDPCGLDALIPDWKEKGAPLNVPVKDDNFYMLGEAGQIRIPNFPMPPL
FT                   MNNHGNYIVSMANVCRWMAEQAEELGVEIFPGMSCSELVYGDNGEVKGVVAGVFGLEAD
FT                   GSYGPNTEPGMELHGKYVFLSEGVRGSLAKEVIAKYDLQKGKEPQKFGVGMKEIWEIDP
FT                   AKHREGSVTHTMGWPLGGNAGGGSFIYHLDNNQVYVGFVVHLNYKNPHLFPYMEFQRFK
FT                   HHPMVAELLKGGKRVAYGARAITEGGYQSMPKMVAPGVALLGCSVGMVNVPRIKGNHNA
FT                   MLSGKAAAEAAHAAIKAGRQSDELSDYETEVRSGPIGKDLKKVRNVKPMWSKWGLAASL
FT                   ALGGLDMWTNTLGFSLFGTLGHGKTDAAATEDASKHKPIDYPKPDGVLSFDRLTNVSFA
FT                   ATNHEESQPCHLRLTDPDLPVKVNLPKYDEPAQRYCPAGVYEVVEDEGGPRFVVNFQNC
FT                   VHCKTCDIKDPSQNITWVTPQGGDGPNYPNM"
     MAEIEREAME YDVVIVGAGP AGLSAAIRLK QLDADLNVVV LEKGSEVGAH ILSGAVLDPC        60
     GLDALIPDWK EKGAPLNVPV KDDNFYMLGE AGQIRIPNFP MPPLMNNHGN YIVSMANVCR       120
     WMAEQAEELG VEIFPGMSCS ELVYGDNGEV KGVVAGVFGL EADGSYGPNT EPGMELHGKY       180
     VFLSEGVRGS LAKEVIAKYD LQKGKEPQKF GVGMKEIWEI DPAKHREGSV THTMGWPLGG       240
     NAGGGSFIYH LDNNQVYVGF VVHLNYKNPH LFPYMEFQRF KHHPMVAELL KGGKRVAYGA       300
     RAITEGGYQS MPKMVAPGVA LLGCSVGMVN VPRIKGNHNA MLSGKAAAEA AHAAIKAGRQ       360
     SDELSDYETE VRSGPIGKDL KKVRNVKPMW SKWGLAASLA LGGLDMWTNT LGFSLFGTLG       420
     HGKTDAAATE DASKHKPIDY PKPDGVLSFD RLTNVSFAAT NHEESQPCHL RLTDPDLPVK       480
     VNLPKYDEPA QRYCPAGVYE VVEDEGGPRF VVNFQNCVHC KTCDIKDPSQ NITWVTPQGG       540
     DGPNYPNM                                                                548
//

If you have problems or comments...

PBIL Back to PBIL home page