(data stored in ACNUC7421 zone)

EMBL: CP000031.PE309

CP000031.PE309       Location/Qualifiers
FT   CDS             332406..332621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0320"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAC45419.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93638"
FT                   /db_xref="GOA:Q5LXB4"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB4"
FT                   /protein_id="AAV93638.1"
FT                   /translation="MKELLRSTDPTVMAFASALLEGEDIDCFQMDVNMSILEGGIGIFP
FT                   RRMMVRDEDYDRALRVVTDNDIPLGR"
     MKELLRSTDP TVMAFASALL EGEDIDCFQM DVNMSILEGG IGIFPRRMMV RDEDYDRALR        60
     VVTDNDIPLG R                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page