(data stored in ACNUC7421 zone)

EMBL: CP000031.PE31

CP000031.PE31        Location/Qualifiers
FT   CDS             31568..32086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0031"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="identified by match to protein family HMM PF03734"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93362"
FT                   /db_xref="GOA:Q5LWI9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWI9"
FT                   /protein_id="AAV93362.2"
FT                   /translation="MDRRHFGLGAAAALGLSACGSQDSKFRRYYGPAVTSIVINKGARK
FT                   MYLLNNEKVLKEYKVELGFAPAGHKQFEGDGKTPEGTYLIDRRNPNSAFHLSLGISYPN
FT                   SRDVAYAQAMGKKPGGEIFIHGEPNGLRDRKKAKKQPDWTAGCIAVKNDEIEEIYAMVR
FT                   DGTVITLRA"
     MDRRHFGLGA AAALGLSACG SQDSKFRRYY GPAVTSIVIN KGARKMYLLN NEKVLKEYKV        60
     ELGFAPAGHK QFEGDGKTPE GTYLIDRRNP NSAFHLSLGI SYPNSRDVAY AQAMGKKPGG       120
     EIFIHGEPNG LRDRKKAKKQ PDWTAGCIAV KNDEIEEIYA MVRDGTVITL RA               172
//

If you have problems or comments...

PBIL Back to PBIL home page