(data stored in ACNUC7421 zone)

EMBL: CP000031.PE312

CP000031.PE312       Location/Qualifiers
FT   CDS             complement(333666..334532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0323"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93641"
FT                   /db_xref="GOA:Q5LXB1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB1"
FT                   /protein_id="AAV93641.1"
FT                   /translation="MTRSRATAIGFVAVLLWALLALLTVGSAPVPPLLLNALCFTVGGL
FT                   LGLVWVLATGGLAQLRGVRWPVYAFGTLGLFGYHALYFSALRLAPAAEAGLIAYLWPLL
FT                   IVLFSGLLPGERLRSGHLLGAALAFAGAGLIITGGGGPGFQAQYLPGYGLALLCALTWS
FT                   GYSVLSRRMGDAPTSSVAVFCLATAVASWGLHFMVEETVWPQDMLGWGATLALGLGPVG
FT                   LAFYVWDIGVKRGDIQLLGTSSYAAPLLSTLVLVISGIAAPSWVLALSALLITGGALLA
FT                   ARASLSA"
     MTRSRATAIG FVAVLLWALL ALLTVGSAPV PPLLLNALCF TVGGLLGLVW VLATGGLAQL        60
     RGVRWPVYAF GTLGLFGYHA LYFSALRLAP AAEAGLIAYL WPLLIVLFSG LLPGERLRSG       120
     HLLGAALAFA GAGLIITGGG GPGFQAQYLP GYGLALLCAL TWSGYSVLSR RMGDAPTSSV       180
     AVFCLATAVA SWGLHFMVEE TVWPQDMLGW GATLALGLGP VGLAFYVWDI GVKRGDIQLL       240
     GTSSYAAPLL STLVLVISGI AAPSWVLALS ALLITGGALL AARASLSA                    288
//

If you have problems or comments...

PBIL Back to PBIL home page