(data stored in ACNUC7421 zone)

EMBL: CP000031.PE313

CP000031.PE313       Location/Qualifiers
FT   CDS             complement(334529..335476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0324"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93642"
FT                   /db_xref="GOA:Q5LXB0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB0"
FT                   /protein_id="AAV93642.1"
FT                   /translation="MSDRLPPLTALRAFDAAARHMSFAKAAAELNVTPAALSFQIKSLE
FT                   EHLGRPLFRRLNRAVELTEEGRALAPGAQEGFEVLTAAWRAARRLQDNTTLTVTAGPAL
FT                   TAKWLAPRLYDFARAHPEIDLRISTSLRLVDLARDEVDVAIRFGQGSDAGLYSVSARKE
FT                   WMIPVMTPELANRFPTPESLRDAPLIFDESISFLDPPVDWPTWFRAVGIDFTPQRGAHF
FT                   SNADHAIDAAVAGVGVVLGRRPMIIKDVIEGRLVMPFKTAVETDARFRFVCLAGAETQP
FT                   KIAAFRDWFLAEIAKTAHISDGLTIVHVRDIPPK"
     MSDRLPPLTA LRAFDAAARH MSFAKAAAEL NVTPAALSFQ IKSLEEHLGR PLFRRLNRAV        60
     ELTEEGRALA PGAQEGFEVL TAAWRAARRL QDNTTLTVTA GPALTAKWLA PRLYDFARAH       120
     PEIDLRISTS LRLVDLARDE VDVAIRFGQG SDAGLYSVSA RKEWMIPVMT PELANRFPTP       180
     ESLRDAPLIF DESISFLDPP VDWPTWFRAV GIDFTPQRGA HFSNADHAID AAVAGVGVVL       240
     GRRPMIIKDV IEGRLVMPFK TAVETDARFR FVCLAGAETQ PKIAAFRDWF LAEIAKTAHI       300
     SDGLTIVHVR DIPPK                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page