(data stored in ACNUC7421 zone)

EMBL: CP000031.PE316

CP000031.PE316       Location/Qualifiers
FT   CDS             complement(338082..338921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0327"
FT                   /product="EAL domain protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93645"
FT                   /db_xref="GOA:Q5LXA7"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA7"
FT                   /protein_id="AAV93645.1"
FT                   /translation="MRTRIKKLADLPEGAENPLSAAISSRHRSTVAMATEAVRHGDCLL
FT                   AYQPVLQTAPPHGIAFYEGFIRVLDETGRVIPARDFMPAVENTEIGRELDCVALETGLR
FT                   ALVRNPTLRLSVNMSARSIGYRKWMQTLERFLKRDEALGDRLILEINQTSAMAVPELVI
FT                   DFMDRLQPRGIAFALDDFGDGPIDFNSFRDFFFDAVKIDGRFIRQVSTDAANRATVRAL
FT                   IALAREFEMLIIAESVETEEDAAFLAENGVDCLQGYLYGAPTVTPVWEKPETAKASG"
     MRTRIKKLAD LPEGAENPLS AAISSRHRST VAMATEAVRH GDCLLAYQPV LQTAPPHGIA        60
     FYEGFIRVLD ETGRVIPARD FMPAVENTEI GRELDCVALE TGLRALVRNP TLRLSVNMSA       120
     RSIGYRKWMQ TLERFLKRDE ALGDRLILEI NQTSAMAVPE LVIDFMDRLQ PRGIAFALDD       180
     FGDGPIDFNS FRDFFFDAVK IDGRFIRQVS TDAANRATVR ALIALAREFE MLIIAESVET       240
     EEDAAFLAEN GVDCLQGYLY GAPTVTPVWE KPETAKASG                              279
//

If you have problems or comments...

PBIL Back to PBIL home page