(data stored in ACNUC7421 zone)

EMBL: CP000031.PE317

CP000031.PE317       Location/Qualifiers
FT   CDS             complement(339136..340068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0328"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB48523.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93646"
FT                   /db_xref="GOA:Q5LXA6"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA6"
FT                   /protein_id="AAV93646.1"
FT                   /translation="MIETLSFPDPTQLAVPFFIAAILIEFLWIAMKKRGGRYETRDAVT
FT                   SLIMGAGSVAEGILLGFIAWAFFMLLWRVTPLDMGTSIWAVLICFVLDDLRYYWVHRFG
FT                   HRVRWVWASHVNHHSSQHYNLTTALRQTWTGTFTFMMVVKAPMVLLGFHPALVLFCGGL
FT                   NLIYQFWIHTEAIDKLPRWFEAVMNTPSHHRVHHGRNPRYLDCNYAGVFIIWDKMFGTF
FT                   VPEQEDEKVDYGLVHNLGTFNPLRVAFHEWLGIWRDVTQPGLSLRQRLAYAFAPPGYSH
FT                   DGSRETSEGIKARYLATHPEQRGTPGFEG"
     MIETLSFPDP TQLAVPFFIA AILIEFLWIA MKKRGGRYET RDAVTSLIMG AGSVAEGILL        60
     GFIAWAFFML LWRVTPLDMG TSIWAVLICF VLDDLRYYWV HRFGHRVRWV WASHVNHHSS       120
     QHYNLTTALR QTWTGTFTFM MVVKAPMVLL GFHPALVLFC GGLNLIYQFW IHTEAIDKLP       180
     RWFEAVMNTP SHHRVHHGRN PRYLDCNYAG VFIIWDKMFG TFVPEQEDEK VDYGLVHNLG       240
     TFNPLRVAFH EWLGIWRDVT QPGLSLRQRL AYAFAPPGYS HDGSRETSEG IKARYLATHP       300
     EQRGTPGFEG                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page