(data stored in ACNUC7421 zone)

EMBL: CP000031.PE32

CP000031.PE32        Location/Qualifiers
FT   CDS             32458..33366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0033"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93364"
FT                   /db_xref="GOA:Q5LWI7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWI7"
FT                   /protein_id="AAV93364.1"
FT                   /translation="MRLPPLNALRAFEAAARHNGYIAAAEELCVTRGAVSRHIKLLEDH
FT                   LGVTLFHRNHRGVELTAAGRQLLPVLTETFARIAREAEQISAMTRDVRIICPPALSIRW
FT                   LFPRLEEFQAAHPDIRVRLTTEFYGAKGFDDTEHDLGVSVEHVSGRGAGIASMPLFPMV
FT                   LSPACSPALLRQRPLSAPADLARMTLLHESPQRRDWAHWLSSFGVRGVDAGSGPTFPNL
FT                   DMAARAATMGAGVVMADLALCQEELRAGTLVLPFPEMTCTTPQGGYVLLGARARWDEPH
FT                   LRAFRDWAASSSADLVACMGA"
     MRLPPLNALR AFEAAARHNG YIAAAEELCV TRGAVSRHIK LLEDHLGVTL FHRNHRGVEL        60
     TAAGRQLLPV LTETFARIAR EAEQISAMTR DVRIICPPAL SIRWLFPRLE EFQAAHPDIR       120
     VRLTTEFYGA KGFDDTEHDL GVSVEHVSGR GAGIASMPLF PMVLSPACSP ALLRQRPLSA       180
     PADLARMTLL HESPQRRDWA HWLSSFGVRG VDAGSGPTFP NLDMAARAAT MGAGVVMADL       240
     ALCQEELRAG TLVLPFPEMT CTTPQGGYVL LGARARWDEP HLRAFRDWAA SSSADLVACM       300
     GA                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page