(data stored in ACNUC7421 zone)

EMBL: CP000031.PE324

CP000031.PE324       Location/Qualifiers
FT   CDS             345684..348242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93653"
FT                   /db_xref="GOA:Q5LXB7"
FT                   /db_xref="InterPro:IPR012683"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB7"
FT                   /protein_id="AAV93653.1"
FT                   /translation="MTRNRPPNLPLPRFALGLTHAGLWAERLWRGFWPFLSVLMLALAP
FT                   ILLGLHELVPVEWVWAFAAGFALVLVVTLVLGLRRFRRPVRAEALARLDAALPGRPIQT
FT                   LMDEQAIGAQDPASAALWRAHQARMAARVANAEPVAPDLVLTRRDPYGLRFMAALCFVA
FT                   ALLFGSVWRVGSVVDLAPGAAQAATGPSWEGWIEPPRYTGLPTLYLNDQTGEVLQLPQG
FT                   SRITLRLYGEVGQLRLTEEVSGKPLERPDHPEQTVEVTRSGPFEIEGRGGRGWQVVMLS
FT                   DTAPQVEIAGAAETRAGGQMVLPFAAMDDYGITGGRAVIALDLEAVDRRYGLRTDPDPR
FT                   DPVVADLPLPITGDRREFTENLIEDFSQHPWAHLPVTITLIAQDAAGQEAETLPFGTAL
FT                   PARRFFDPLAAAVIEQRRDLLWSRDNATRVAQILRAVSHRPDDVFRSQTAYLRLRVILR
FT                   RMEALQRFGLKPAQQEEIAQALWDLAIMLEDGTLSDALERMRRAQERLSEAMKNGASDQ
FT                   EIAELMQELREATQDYLRQLAQNQQNEQDGERQAQEGESLQMTQDDLQKMMDRIQELME
FT                   QGRMAEAQQALEEFQQMMENMRVTQGQGDNGQSEGQRAMEGLAETLRNQQGLSDQAFRD
FT                   LQEQFNPGAQAGESQQNEGRNGGEGRGQSHEGQGQGSRQSGTGQDGAQQGEPGETGEGS
FT                   LAERQQALRNELGRQEQNLPGQGTPEGDAAREALDRAGRAMEGAEEALRENDLAEAIDR
FT                   QAEAMEAMREGMRSLGEALAQQSQPGQGSQEGDQRARNQDPLGRTPGSQGGVDTDESLV
FT                   PGDDVYRRARDLLDEIRRRSGESDRPKVERDYLKRLLDRF"
     MTRNRPPNLP LPRFALGLTH AGLWAERLWR GFWPFLSVLM LALAPILLGL HELVPVEWVW        60
     AFAAGFALVL VVTLVLGLRR FRRPVRAEAL ARLDAALPGR PIQTLMDEQA IGAQDPASAA       120
     LWRAHQARMA ARVANAEPVA PDLVLTRRDP YGLRFMAALC FVAALLFGSV WRVGSVVDLA       180
     PGAAQAATGP SWEGWIEPPR YTGLPTLYLN DQTGEVLQLP QGSRITLRLY GEVGQLRLTE       240
     EVSGKPLERP DHPEQTVEVT RSGPFEIEGR GGRGWQVVML SDTAPQVEIA GAAETRAGGQ       300
     MVLPFAAMDD YGITGGRAVI ALDLEAVDRR YGLRTDPDPR DPVVADLPLP ITGDRREFTE       360
     NLIEDFSQHP WAHLPVTITL IAQDAAGQEA ETLPFGTALP ARRFFDPLAA AVIEQRRDLL       420
     WSRDNATRVA QILRAVSHRP DDVFRSQTAY LRLRVILRRM EALQRFGLKP AQQEEIAQAL       480
     WDLAIMLEDG TLSDALERMR RAQERLSEAM KNGASDQEIA ELMQELREAT QDYLRQLAQN       540
     QQNEQDGERQ AQEGESLQMT QDDLQKMMDR IQELMEQGRM AEAQQALEEF QQMMENMRVT       600
     QGQGDNGQSE GQRAMEGLAE TLRNQQGLSD QAFRDLQEQF NPGAQAGESQ QNEGRNGGEG       660
     RGQSHEGQGQ GSRQSGTGQD GAQQGEPGET GEGSLAERQQ ALRNELGRQE QNLPGQGTPE       720
     GDAAREALDR AGRAMEGAEE ALRENDLAEA IDRQAEAMEA MREGMRSLGE ALAQQSQPGQ       780
     GSQEGDQRAR NQDPLGRTPG SQGGVDTDES LVPGDDVYRR ARDLLDEIRR RSGESDRPKV       840
     ERDYLKRLLD RF                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page