(data stored in ACNUC7421 zone)

EMBL: CP000031.PE325

CP000031.PE325       Location/Qualifiers
FT   CDS             complement(348262..349101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0336"
FT                   /product="MJ0042 family finger-like domain protein"
FT                   /note="identified by match to protein family HMM TIGR02098"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93654"
FT                   /db_xref="GOA:Q5LXB6"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB6"
FT                   /protein_id="AAV93654.1"
FT                   /translation="MRLTCPNCDAQYEVPDEVIPPEGRDVQCSNCGHTWFQPPAGEALD
FT                   ADEGDAEDGFAPDAAPAPEEDTSESPDQSDEQDDWDEDGELPDDKDEDSFDNDPAPTDP
FT                   VQGRGVGPDVSDILREEAAREAELRAREAEALESQPDLGLDAYPGDEPGRRAREAQDRM
FT                   ARMRGQEPVAQETDSTSRRGLLPDIEEINSTLRNSDAAAAAPAIHAGPARRRRSGGFMR
FT                   GFVVMLIFGAVLFLLYTNAPLVARTLPQADPMLSAYVALVDQARLWLDAQIGALIPR"
     MRLTCPNCDA QYEVPDEVIP PEGRDVQCSN CGHTWFQPPA GEALDADEGD AEDGFAPDAA        60
     PAPEEDTSES PDQSDEQDDW DEDGELPDDK DEDSFDNDPA PTDPVQGRGV GPDVSDILRE       120
     EAAREAELRA REAEALESQP DLGLDAYPGD EPGRRAREAQ DRMARMRGQE PVAQETDSTS       180
     RRGLLPDIEE INSTLRNSDA AAAAPAIHAG PARRRRSGGF MRGFVVMLIF GAVLFLLYTN       240
     APLVARTLPQ ADPMLSAYVA LVDQARLWLD AQIGALIPR                              279
//

If you have problems or comments...

PBIL Back to PBIL home page