(data stored in ACNUC9435 zone)

EMBL: CP000031.PE333

CP000031.PE333       Location/Qualifiers
FT   CDS             complement(358122..358784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0344a"
FT                   /product="hypothetical protein"
FT                   /note="'Novel gene detected by proteogenomics, SPO_PG005;
FT                   not identified in other Roseobacter strains'"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0344a"
FT                   /db_xref="EnsemblGenomes-Tr:AHB86005"
FT                   /db_xref="GOA:V5UZC2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:V5UZC2"
FT                   /protein_id="AHB86005.1"
FT                   /translation="MFGPISGQVHGTGAKALVIVLHGDSGPDYITSFAADLARRNPQST
FT                   VIQMARPGYSIAGRRSKGSNSGSRDHYTKQNNNLLAQGISAASQAYPHNRLVVVAHSGG
FT                   AAQTGTLLGTVPGLIDIAVMVSGPFDIPRWRASRGTPWPKSQSPIRYLDQIPRQTKIIA
FT                   VTGQQDSNTQPGLARDYVAKAQARGLNATFTAIPNAGHSFRSLKEPVLAIATREIQS"
     MFGPISGQVH GTGAKALVIV LHGDSGPDYI TSFAADLARR NPQSTVIQMA RPGYSIAGRR        60
     SKGSNSGSRD HYTKQNNNLL AQGISAASQA YPHNRLVVVA HSGGAAQTGT LLGTVPGLID       120
     IAVMVSGPFD IPRWRASRGT PWPKSQSPIR YLDQIPRQTK IIAVTGQQDS NTQPGLARDY       180
     VAKAQARGLN ATFTAIPNAG HSFRSLKEPV LAIATREIQS                             220
//

If you have problems or comments...

PBIL Back to PBIL home page