(data stored in ACNUC7421 zone)

EMBL: CP000031.PE336

CP000031.PE336       Location/Qualifiers
FT   CDS             complement(360402..360911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0346a"
FT                   /product="hypothetical protein"
FT                   /note="'Novel gene detected by proteogenomics, SPO_PG006;
FT                   not identified in other Roseobacter strains'"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0346a"
FT                   /db_xref="EnsemblGenomes-Tr:AHB86006"
FT                   /db_xref="UniProtKB/TrEMBL:V5UYD5"
FT                   /protein_id="AHB86006.1"
FT                   /translation="MQRAILGIIASAFLVGCTDTSLSTSGGGSTRSQTQVVSYEDAVNA
FT                   FIEACVKTAASPNSAPQAFEALGFGKKENRNGGYDFQSPYATAQVSLRAGVGKTTELGQ
FT                   CQVIPNGGNFQTSAALLSQQISKPSFRAKRVPGNTSWFLGNTGTIAIVSFNKGMMVRTQ
FT                   RLASSQ"
     MQRAILGIIA SAFLVGCTDT SLSTSGGGST RSQTQVVSYE DAVNAFIEAC VKTAASPNSA        60
     PQAFEALGFG KKENRNGGYD FQSPYATAQV SLRAGVGKTT ELGQCQVIPN GGNFQTSAAL       120
     LSQQISKPSF RAKRVPGNTS WFLGNTGTIA IVSFNKGMMV RTQRLASSQ                   169
//

If you have problems or comments...

PBIL Back to PBIL home page