(data stored in ACNUC7421 zone)

EMBL: CP000031.PE337

CP000031.PE337       Location/Qualifiers
FT   CDS             complement(360913..362106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0347"
FT                   /product="succinyl-CoA synthase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="identified by similarity to SP:P07460; match to
FT                   protein family HMM PF00549; match to protein family HMM
FT                   PF02222; match to protein family HMM TIGR01016"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93665"
FT                   /db_xref="GOA:Q5LXC4"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXC4"
FT                   /protein_id="AAV93665.1"
FT                   /translation="MNIHEYQAKALLRSYGAPVSDGRVVLRAEDAKTAAGELDGPLWVV
FT                   KAQIHAGGRGKGKFKEADAGEKGGVRLTKSVEEAAEEAKKMLGRTLVTHQTGPVGKQVN
FT                   RIYIEAGSGIERELYLALLVDRQTSRISFVCSTEGGMDIEEVAASTPEKILSFSVDPVT
FT                   GYQPYHGRRIAFSLGLEGPQVKQCVALMGLLYKAFVEKDMEMLEINPLIVAEGGSLKVL
FT                   DAKVGFDGNAIYRHSDIAELRDTTEEDPKELEASKYDLNYIALDGEIGCMVNGAGLAMA
FT                   TMDIIKLYGAEPANFLDVGGGATKEKVTEAFKIITSDPNVKGILVNIFGGIMRCDVIAE
FT                   GVVAAVKEVGLQVPLVVRLEGTNVEKGKEIINTSGLNVIAADNLSDGAEKIVKAVKG"
     MNIHEYQAKA LLRSYGAPVS DGRVVLRAED AKTAAGELDG PLWVVKAQIH AGGRGKGKFK        60
     EADAGEKGGV RLTKSVEEAA EEAKKMLGRT LVTHQTGPVG KQVNRIYIEA GSGIERELYL       120
     ALLVDRQTSR ISFVCSTEGG MDIEEVAAST PEKILSFSVD PVTGYQPYHG RRIAFSLGLE       180
     GPQVKQCVAL MGLLYKAFVE KDMEMLEINP LIVAEGGSLK VLDAKVGFDG NAIYRHSDIA       240
     ELRDTTEEDP KELEASKYDL NYIALDGEIG CMVNGAGLAM ATMDIIKLYG AEPANFLDVG       300
     GGATKEKVTE AFKIITSDPN VKGILVNIFG GIMRCDVIAE GVVAAVKEVG LQVPLVVRLE       360
     GTNVEKGKEI INTSGLNVIA ADNLSDGAEK IVKAVKG                                397
//

If you have problems or comments...

PBIL Back to PBIL home page