(data stored in ACNUC9435 zone)

EMBL: CP000031.PE34

CP000031.PE34        Location/Qualifiers
FT   CDS             complement(34823..36502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0035"
FT                   /product="core-2/I-branching enzyme family protein"
FT                   /note="identified by match to protein family HMM PF02485"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93366"
FT                   /db_xref="GOA:Q5LWI5"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWI5"
FT                   /protein_id="AAV93366.1"
FT                   /translation="MLVHTALDRAQQVAQHWTASGCPVVIHVDRKVSRKTFKAFHDACV
FT                   KDPLIRFSTRHRCEWGTWGIVAASQAASEQMLAEFADVRHVYLASGSCLPLRPVQELID
FT                   YLAARPRTDFIESATTADVPWTVGGLDQERFTLRFPFSWKKHRYLFDKYVNLQRRLGFK
FT                   RRIPAGLVPHMGSQWWCLTRHTLSAILEDPERTVYDAYFRKVWIPDESYFQTLARQFSA
FT                   NIESRSLTLSKFDFQGKPHIFYDDHLQLLRRSDCFVARKIWPRAERLYQAFLTDQAGAM
FT                   KRTEPNPGKIDRIFAKAVERRTRGRDGLYMQSRFPRHGNENGLTSNPYSVFQGFTELFE
FT                   DFEPWLAKATGTRVHGHLFGPERAEFAGGERLVNGALSDCALLRDYNPTSFLTSLIWNT
FT                   RGERQCFQFGPADNQKIDWLLARDPNAQISVITGAWAVPLFKSNRNFADLRKEAARLQR
FT                   IESKHLEILRSVWTKARVRIWTMAEFVEAPMEPIQTIVDEIGQSSPRRLTEAPTMVDLT
FT                   GFGQFLQNLKNQGMHPYLMGDFPVEPAPINNPKPTRKPYLVR"
     MLVHTALDRA QQVAQHWTAS GCPVVIHVDR KVSRKTFKAF HDACVKDPLI RFSTRHRCEW        60
     GTWGIVAASQ AASEQMLAEF ADVRHVYLAS GSCLPLRPVQ ELIDYLAARP RTDFIESATT       120
     ADVPWTVGGL DQERFTLRFP FSWKKHRYLF DKYVNLQRRL GFKRRIPAGL VPHMGSQWWC       180
     LTRHTLSAIL EDPERTVYDA YFRKVWIPDE SYFQTLARQF SANIESRSLT LSKFDFQGKP       240
     HIFYDDHLQL LRRSDCFVAR KIWPRAERLY QAFLTDQAGA MKRTEPNPGK IDRIFAKAVE       300
     RRTRGRDGLY MQSRFPRHGN ENGLTSNPYS VFQGFTELFE DFEPWLAKAT GTRVHGHLFG       360
     PERAEFAGGE RLVNGALSDC ALLRDYNPTS FLTSLIWNTR GERQCFQFGP ADNQKIDWLL       420
     ARDPNAQISV ITGAWAVPLF KSNRNFADLR KEAARLQRIE SKHLEILRSV WTKARVRIWT       480
     MAEFVEAPME PIQTIVDEIG QSSPRRLTEA PTMVDLTGFG QFLQNLKNQG MHPYLMGDFP       540
     VEPAPINNPK PTRKPYLVR                                                    559
//

If you have problems or comments...

PBIL Back to PBIL home page