(data stored in ACNUC7421 zone)

EMBL: CP000031.PE340

CP000031.PE340       Location/Qualifiers
FT   CDS             364683..365438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0350"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93668"
FT                   /db_xref="GOA:Q5LXE0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE0"
FT                   /protein_id="AAV93668.1"
FT                   /translation="MLEPDIGFFAVTIPAVIFAGISKGGFGSGVAFASASILAIYLDPG
FT                   QALALMLPLLMLIDLATLKPYWRRWSWPDARLLILGGLPGVALGALLYRATDADLLRLL
FT                   IGGISLAFVAWQMLRGRGWMREFASRLPPAAGLLAGAVAGFTSFVSHAGGPPAAVYLLS
FT                   QRLGKTEFQATTVLTFWALNIAKFVPYAWLGMFTLDTARAGLLLAPFALLGAWLGVRAH
FT                   HMVPERAFFALAHAMLTLTGLKLIWDALV"
     MLEPDIGFFA VTIPAVIFAG ISKGGFGSGV AFASASILAI YLDPGQALAL MLPLLMLIDL        60
     ATLKPYWRRW SWPDARLLIL GGLPGVALGA LLYRATDADL LRLLIGGISL AFVAWQMLRG       120
     RGWMREFASR LPPAAGLLAG AVAGFTSFVS HAGGPPAAVY LLSQRLGKTE FQATTVLTFW       180
     ALNIAKFVPY AWLGMFTLDT ARAGLLLAPF ALLGAWLGVR AHHMVPERAF FALAHAMLTL       240
     TGLKLIWDAL V                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page