(data stored in ACNUC7421 zone)

EMBL: CP000031.PE341

CP000031.PE341       Location/Qualifiers
FT   CDS             complement(365521..365835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0351"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAC45660.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93669"
FT                   /db_xref="GOA:Q5LXD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD9"
FT                   /protein_id="AAV93669.1"
FT                   /translation="MKTMMIKMTMGLGLMALAAGQLQAQGNNCAPRQMVLDQLAQKYGE
FT                   ARRGIGLVQQGSVMEVFASDETGTWTITVTLPNGMTCMVASGQSYEALAEALPTSGNDA
FT                   "
     MKTMMIKMTM GLGLMALAAG QLQAQGNNCA PRQMVLDQLA QKYGEARRGI GLVQQGSVME        60
     VFASDETGTW TITVTLPNGM TCMVASGQSY EALAEALPTS GNDA                        104
//

If you have problems or comments...

PBIL Back to PBIL home page