(data stored in ACNUC7421 zone)

EMBL: CP000031.PE343

CP000031.PE343       Location/Qualifiers
FT   CDS             367011..367565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0353"
FT                   /product="NnrU family protein"
FT                   /note="identified by match to protein family HMM PF07298"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93671"
FT                   /db_xref="GOA:Q5LXD7"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD7"
FT                   /protein_id="AAV93671.1"
FT                   /translation="MGFVLLILGIAVWWAAHLFKRAMPARRAAMGDRGKGMVALALLGS
FT                   VVLMVIGYRMTDYIHVWAPPSYLTHANNLLVLVAIWMMSPAGTKGKLLHKMRHPMLAGF
FT                   RAWAAAHLLVNGDLASIILFGGLFLWGIVEVAAINAAEPEWTPGEPGTLGKDAMFLVAS
FT                   VVLMAVIGYIHGLVGPWPFPA"
     MGFVLLILGI AVWWAAHLFK RAMPARRAAM GDRGKGMVAL ALLGSVVLMV IGYRMTDYIH        60
     VWAPPSYLTH ANNLLVLVAI WMMSPAGTKG KLLHKMRHPM LAGFRAWAAA HLLVNGDLAS       120
     IILFGGLFLW GIVEVAAINA AEPEWTPGEP GTLGKDAMFL VASVVLMAVI GYIHGLVGPW       180
     PFPA                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page