(data stored in ACNUC9435 zone)

EMBL: CP000031.PE345

CP000031.PE345       Location/Qualifiers
FT   CDS             367782..368810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0355"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAK25618.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93673"
FT                   /db_xref="GOA:Q5LXD5"
FT                   /db_xref="InterPro:IPR016790"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD5"
FT                   /protein_id="AAV93673.1"
FT                   /translation="MAKTNPGRFFEDYTVGQTLHHAVPRTVTNGERALYHALYPARHAL
FT                   YSSDAFAQSCGLPGSPIDDLAAFHVVFGKTVPDVSLNAVANLGYAEGRWLKPVYAGDTL
FT                   RSVSEVIGLKQNSNGKTGVVYVRTRGLNQRDETVMEYVRWVMVRKRDLDAPAPEIVVPE
FT                   LKKALAPNDLVVPEGLDFTAYDFALAGEPHRWGDYAVGETIDHVDGVTVEEAEHMLATR
FT                   LWQNTAKVHFDLTFRPDGRLIYGGHVISMARALSFNGLANAQIIVGLNGGAHANPCFAG
FT                   DTIKAWTEVLDKAETAAPGVGALRLRLVATKGGAPFALHGEDGKYLPEVLLDLDYWVLM
FT                   PK"
     MAKTNPGRFF EDYTVGQTLH HAVPRTVTNG ERALYHALYP ARHALYSSDA FAQSCGLPGS        60
     PIDDLAAFHV VFGKTVPDVS LNAVANLGYA EGRWLKPVYA GDTLRSVSEV IGLKQNSNGK       120
     TGVVYVRTRG LNQRDETVME YVRWVMVRKR DLDAPAPEIV VPELKKALAP NDLVVPEGLD       180
     FTAYDFALAG EPHRWGDYAV GETIDHVDGV TVEEAEHMLA TRLWQNTAKV HFDLTFRPDG       240
     RLIYGGHVIS MARALSFNGL ANAQIIVGLN GGAHANPCFA GDTIKAWTEV LDKAETAAPG       300
     VGALRLRLVA TKGGAPFALH GEDGKYLPEV LLDLDYWVLM PK                          342
//

If you have problems or comments...

PBIL Back to PBIL home page