(data stored in ACNUC7421 zone)

EMBL: CP000031.PE347

CP000031.PE347       Location/Qualifiers
FT   CDS             369582..370244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0357"
FT                   /product="von Willebrand factor type A domain protein"
FT                   /note="identified by match to protein family HMM PF00092"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93675"
FT                   /db_xref="GOA:Q5LXF1"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR010607"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF1"
FT                   /protein_id="AAV93675.1"
FT                   /translation="MSFWRVFLFGLFLTPPAAACDLALALAVDVSGSVDEGEYRTQMDG
FT                   LAHALRDPVVSEALVRAEAQLMLVQWTGSDRQRVTIPWTQASSFDALDRFADRVAADPR
FT                   IWRNYSTAIGEALEVTMAAFAQVPDCARHLIDVSGDGPSNEGIEPLAVHRDLRALGITV
FT                   NAIAIEQSEPDLTAYFYENVIVGEGAFVETANGFADYPARIRKKLLREVTQQTAALD"
     MSFWRVFLFG LFLTPPAAAC DLALALAVDV SGSVDEGEYR TQMDGLAHAL RDPVVSEALV        60
     RAEAQLMLVQ WTGSDRQRVT IPWTQASSFD ALDRFADRVA ADPRIWRNYS TAIGEALEVT       120
     MAAFAQVPDC ARHLIDVSGD GPSNEGIEPL AVHRDLRALG ITVNAIAIEQ SEPDLTAYFY       180
     ENVIVGEGAF VETANGFADY PARIRKKLLR EVTQQTAALD                             220
//

If you have problems or comments...

PBIL Back to PBIL home page