(data stored in ACNUC7421 zone)

EMBL: CP000031.PE353

CP000031.PE353       Location/Qualifiers
FT   CDS             374164..376323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0362"
FT                   /product="type I secretion target repeat protein"
FT                   /note="identified by match to protein family HMM PF00353"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93680"
FT                   /db_xref="GOA:Q5LXE6"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE6"
FT                   /protein_id="AAV93680.1"
FT                   /translation="MPTLTELNSEYSVVSSGLAQSGPQNAALSDGRQVVTWQTRTGLLY
FT                   FKIVDSEGKSTGSSTLVSTIVGPNSPSDVKTLSDGSFIVVYTEQISSNNSEIRATRYSD
FT                   TGQKIGTEMNLMTDAREILFAPTVTSLSDGGFAVLSGGYSSSDSDHSTFVRAFDIDGTP
FT                   RGPMAQLDLTTAGKQVFPEAVGVENGGLVAVWTSGTGDGSGTSVKMRLVDGNGVPQGRE
FT                   IQVNQYTPSDQQEPAIARLDDGSVIVVWHSKGQDGSEGSIIARHFSAQGVPQGNEFIVN
FT                   VTRAGEQTLPTVVALNEGGFVVAWTNLTSRPDTMARQYDYNLRPVTGEIKLSQGSLSRD
FT                   IGPELSALSNGGVGFVWMDISVVASLPTLGVEVRTTHPSDFNPTEGNDLLSGDAGNNRI
FT                   FARDGDDWVSPGIGSDTVDGGAGNDMVSFIDHRQAVRVDLSEGRVTSGRDINHLSNVEN
FT                   VTGSSFADYIVGDDGDNRLRGAGSYDWFIGSDGADFYDGGSGRDMVSYVSSSGAVQVDL
FT                   TRGRGQGGMAEGDRYQSIERVTGSSFEDHLTGDAGDNDLRGLGSYDWFVGTAGRDRYDG
FT                   GSGLDMISYASSSAAVSVDLSQGRGTRGDAAKDSYVSVERVTGSSHDDVLIGDDGRNVL
FT                   RGLYGEDTLLGNAGVDRLHGGASDDFLDGGAGWDFAIFDGNRDDYNVTRQGERTLVERV
FT                   SPGNEGIDTLVNIEVIQFQDDFLYL"
     MPTLTELNSE YSVVSSGLAQ SGPQNAALSD GRQVVTWQTR TGLLYFKIVD SEGKSTGSST        60
     LVSTIVGPNS PSDVKTLSDG SFIVVYTEQI SSNNSEIRAT RYSDTGQKIG TEMNLMTDAR       120
     EILFAPTVTS LSDGGFAVLS GGYSSSDSDH STFVRAFDID GTPRGPMAQL DLTTAGKQVF       180
     PEAVGVENGG LVAVWTSGTG DGSGTSVKMR LVDGNGVPQG REIQVNQYTP SDQQEPAIAR       240
     LDDGSVIVVW HSKGQDGSEG SIIARHFSAQ GVPQGNEFIV NVTRAGEQTL PTVVALNEGG       300
     FVVAWTNLTS RPDTMARQYD YNLRPVTGEI KLSQGSLSRD IGPELSALSN GGVGFVWMDI       360
     SVVASLPTLG VEVRTTHPSD FNPTEGNDLL SGDAGNNRIF ARDGDDWVSP GIGSDTVDGG       420
     AGNDMVSFID HRQAVRVDLS EGRVTSGRDI NHLSNVENVT GSSFADYIVG DDGDNRLRGA       480
     GSYDWFIGSD GADFYDGGSG RDMVSYVSSS GAVQVDLTRG RGQGGMAEGD RYQSIERVTG       540
     SSFEDHLTGD AGDNDLRGLG SYDWFVGTAG RDRYDGGSGL DMISYASSSA AVSVDLSQGR       600
     GTRGDAAKDS YVSVERVTGS SHDDVLIGDD GRNVLRGLYG EDTLLGNAGV DRLHGGASDD       660
     FLDGGAGWDF AIFDGNRDDY NVTRQGERTL VERVSPGNEG IDTLVNIEVI QFQDDFLYL        719
//

If you have problems or comments...

PBIL Back to PBIL home page