(data stored in ACNUC7421 zone)

EMBL: CP000031.PE359

CP000031.PE359       Location/Qualifiers
FT   CDS             complement(380565..382565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0368"
FT                   /product="methylmalonyl-CoA mutase"
FT                   /EC_number="5.4.99.2"
FT                   /note="identified by similarity to SP:Q49115; match to
FT                   protein family HMM PF01642; match to protein family HMM
FT                   PF02310; match to protein family HMM TIGR00640; match to
FT                   protein family HMM TIGR00641"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93686"
FT                   /db_xref="GOA:Q5LXF8"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF8"
FT                   /protein_id="AAV93686.1"
FT                   /translation="MSQMQKDRQTANPDRKADRPWLIRTYAGHSTAKASNTLYRNNLSK
FT                   GQTGLSVAFDLPTQTGYDSDHVLARGEVGKVGVPICHLGDMRVLFDQIPLEQMNTSMTI
FT                   NATAPWLLALYIAVAEEQGADVSKLQGTVQNDLIKEYLSRGTYVCPPKPSLKMIADVAE
FT                   YCYTNVPKWNPMNVCSYHLQEAGATPEQELAYALATAIAVLDELKPRVPAEDFPALCGR
FT                   ISFFVNAGIRFVTEMCKMRAFVDLWDEILESRYGVSDPKFRRFRYGVQVNSLGLTEQQP
FT                   ENNVYRILIEMLAVTLSKKARARAVQLPAWNEALGLPRPWDQQWSMRMQQILAYETDLL
FT                   EFGDLFDGNPVVDAKVEELKAGARAELANLDSMGGAVASIEYMKSRLVDSNAERLNRIE
FT                   RNETVVVGVNRWTEGEPSPLQTEDGGIMVVDPAVEQEQIARLESWRADRDDAAVAAALE
FT                   ALRAAARTGANVMEPSIAAARAGVTTGEWAEEMRKAYGTYRGPTGVSGSVSNKTEGLED
FT                   LRAAVDAASDKLGRRLKFLVGKPGLDGHSNGAEQIAFRARDCGMDISYDGIRLTPEELV
FT                   ASALDQQAHVVGLSILSGSHLPLVEEVMERMKKAGLAHIPVIVGGIIPDEDSQKLRAMG
FT                   VAKVYTPKDFELNGIMGDIVTLVSDTEIAAE"
     MSQMQKDRQT ANPDRKADRP WLIRTYAGHS TAKASNTLYR NNLSKGQTGL SVAFDLPTQT        60
     GYDSDHVLAR GEVGKVGVPI CHLGDMRVLF DQIPLEQMNT SMTINATAPW LLALYIAVAE       120
     EQGADVSKLQ GTVQNDLIKE YLSRGTYVCP PKPSLKMIAD VAEYCYTNVP KWNPMNVCSY       180
     HLQEAGATPE QELAYALATA IAVLDELKPR VPAEDFPALC GRISFFVNAG IRFVTEMCKM       240
     RAFVDLWDEI LESRYGVSDP KFRRFRYGVQ VNSLGLTEQQ PENNVYRILI EMLAVTLSKK       300
     ARARAVQLPA WNEALGLPRP WDQQWSMRMQ QILAYETDLL EFGDLFDGNP VVDAKVEELK       360
     AGARAELANL DSMGGAVASI EYMKSRLVDS NAERLNRIER NETVVVGVNR WTEGEPSPLQ       420
     TEDGGIMVVD PAVEQEQIAR LESWRADRDD AAVAAALEAL RAAARTGANV MEPSIAAARA       480
     GVTTGEWAEE MRKAYGTYRG PTGVSGSVSN KTEGLEDLRA AVDAASDKLG RRLKFLVGKP       540
     GLDGHSNGAE QIAFRARDCG MDISYDGIRL TPEELVASAL DQQAHVVGLS ILSGSHLPLV       600
     EEVMERMKKA GLAHIPVIVG GIIPDEDSQK LRAMGVAKVY TPKDFELNGI MGDIVTLVSD       660
     TEIAAE                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page