(data stored in ACNUC7421 zone)

EMBL: CP000031.PE36

CP000031.PE36        Location/Qualifiers
FT   CDS             complement(37703..38752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0037"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAC46616.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93368"
FT                   /db_xref="GOA:Q5LWI3"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWI3"
FT                   /protein_id="AAV93368.1"
FT                   /translation="MTSSPAPPLSPIGWADAYRLRWKRQRLLWRAFRSRRALTALADRT
FT                   AAIRPGQVLAVTTLRNEVLRLPWFLDYYRTLGVGHFLMVDNGSDDGSVEMLAAQPDVSL
FT                   WQTGASYRDARFGLDWMTWLQIRHAHGHWCLMVDVDELLIYAHHDRRDLHALTGWLERQ
FT                   GRNCFGAHMLDLYPKGPVAAQTHAPGEDPLDILHWFDAAPYRAQRQQPLGNLWVQGGAR
FT                   ERMFFADDPRRSPTLNKIPLIRWDRRYAYVNSCHSALPRQLNAVYGGPGDSAPSGVLLH
FT                   TKFLPDIVSRSAEEKTRQQHFHTPADFDHYYDDLTASPDFWTPSSTRFTGWRQLHDLGL
FT                   LSPGGWEEG"
     MTSSPAPPLS PIGWADAYRL RWKRQRLLWR AFRSRRALTA LADRTAAIRP GQVLAVTTLR        60
     NEVLRLPWFL DYYRTLGVGH FLMVDNGSDD GSVEMLAAQP DVSLWQTGAS YRDARFGLDW       120
     MTWLQIRHAH GHWCLMVDVD ELLIYAHHDR RDLHALTGWL ERQGRNCFGA HMLDLYPKGP       180
     VAAQTHAPGE DPLDILHWFD AAPYRAQRQQ PLGNLWVQGG ARERMFFADD PRRSPTLNKI       240
     PLIRWDRRYA YVNSCHSALP RQLNAVYGGP GDSAPSGVLL HTKFLPDIVS RSAEEKTRQQ       300
     HFHTPADFDH YYDDLTASPD FWTPSSTRFT GWRQLHDLGL LSPGGWEEG                   349
//

If you have problems or comments...

PBIL Back to PBIL home page