(data stored in ACNUC7421 zone)

EMBL: CP000031.PE360

CP000031.PE360       Location/Qualifiers
FT   CDS             382532..384115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0369"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by similarity to SP:P00482; match to
FT                   protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93687"
FT                   /db_xref="GOA:Q5LXF7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF7"
FT                   /protein_id="AAV93687.1"
FT                   /translation="MQSDGLFASATWTALRFWFGNKVSLEGSKSQFSGHVNSLHRGNHR
FT                   AHQTIVRPRIWWQGAGMTQTVELPLWLFVLIVLFAAVTFASHFLFPSVRWFFRRRLERA
FT                   VARLNTRLARPIQPFKLARRHDMIQRLIYDPEVARAVRDQAQAEGIPEAVAFEQAQRYA
FT                   REIVPGFSAFAYFSFAIRLARFLSNALYRVRLRHVDAEALRAIDPEATVVFVMNHRSNM
FT                   DYVLVTYLAAEQSALSYAVGEWARVWPLSRLIRAMGAYFIRRKSRSDLYRKVLAAYVRH
FT                   ATDAGVTQAMFPEGGLSLSGGLGRPKLGLLKYIVDGAIPEGRDVVFVPVSINYDRVLED
FT                   TILTAAASRGERRFRARIGVITMWFLKQMWWRMTGRFHRFGYAAVSFGRPLSLSEFRVR
FT                   TKGDPTVPLARELMSRIGVVVPVLPVPLVAWLILRNGPMTRSALAAGFDKVLAALPHAH
FT                   IHMPRDDRHYAIEVGLRQLIERRIIVETDGRFGPGTERQDLLTYYAASIAHLMDGGAAY
FT                   AEELSAIAGS"
     MQSDGLFASA TWTALRFWFG NKVSLEGSKS QFSGHVNSLH RGNHRAHQTI VRPRIWWQGA        60
     GMTQTVELPL WLFVLIVLFA AVTFASHFLF PSVRWFFRRR LERAVARLNT RLARPIQPFK       120
     LARRHDMIQR LIYDPEVARA VRDQAQAEGI PEAVAFEQAQ RYAREIVPGF SAFAYFSFAI       180
     RLARFLSNAL YRVRLRHVDA EALRAIDPEA TVVFVMNHRS NMDYVLVTYL AAEQSALSYA       240
     VGEWARVWPL SRLIRAMGAY FIRRKSRSDL YRKVLAAYVR HATDAGVTQA MFPEGGLSLS       300
     GGLGRPKLGL LKYIVDGAIP EGRDVVFVPV SINYDRVLED TILTAAASRG ERRFRARIGV       360
     ITMWFLKQMW WRMTGRFHRF GYAAVSFGRP LSLSEFRVRT KGDPTVPLAR ELMSRIGVVV       420
     PVLPVPLVAW LILRNGPMTR SALAAGFDKV LAALPHAHIH MPRDDRHYAI EVGLRQLIER       480
     RIIVETDGRF GPGTERQDLL TYYAASIAHL MDGGAAYAEE LSAIAGS                     527
//

If you have problems or comments...

PBIL Back to PBIL home page