(data stored in ACNUC7421 zone)

EMBL: CP000031.PE366

CP000031.PE366       Location/Qualifiers
FT   CDS             complement(389848..390798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0375"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93693"
FT                   /db_xref="GOA:Q5LXG6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG6"
FT                   /protein_id="AAV93693.1"
FT                   /translation="MAGHAGLTKNMQIYLPIAEVSVNAFLLLGLGGMVGILSGMFGVGG
FT                   GFLMTPLLFFIGIPPAVAVATEANQIVASSFSGVLAHFRRRTVDFRMGTILLIGGLSGA
FT                   ALGVVLFNYLKSLGQVDLLVKLCYVVFLGIIGGLMFIESLNAIRKSRKAGGAVPKRRQR
FT                   GWIHAMPFKMRFRTSGLYISVIPPIVVGLLVGVLSAIMGVGGGFIMVPAMIYLLGMPTK
FT                   VVVGTSLFQIIFVTAFTTMLHATTNYTVDVVLAVLLLVGGVIGAQIGTVIGARMKAEQL
FT                   RILLAGLVLAVCAKLALDLLLMPSELYSLGASGGH"
     MAGHAGLTKN MQIYLPIAEV SVNAFLLLGL GGMVGILSGM FGVGGGFLMT PLLFFIGIPP        60
     AVAVATEANQ IVASSFSGVL AHFRRRTVDF RMGTILLIGG LSGAALGVVL FNYLKSLGQV       120
     DLLVKLCYVV FLGIIGGLMF IESLNAIRKS RKAGGAVPKR RQRGWIHAMP FKMRFRTSGL       180
     YISVIPPIVV GLLVGVLSAI MGVGGGFIMV PAMIYLLGMP TKVVVGTSLF QIIFVTAFTT       240
     MLHATTNYTV DVVLAVLLLV GGVIGAQIGT VIGARMKAEQ LRILLAGLVL AVCAKLALDL       300
     LLMPSELYSL GASGGH                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page