(data stored in ACNUC7421 zone)

EMBL: CP000031.PE370

CP000031.PE370       Location/Qualifiers
FT   CDS             complement(394572..395570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0379"
FT                   /product="sugar ABC transporter, periplasmic sugar-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02608"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93697"
FT                   /db_xref="GOA:Q5LXG2"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG2"
FT                   /protein_id="AAV93697.1"
FT                   /translation="MTLMKSLMGAAAAMALTAGAALAEPALIFDLGGKFDKSFNEAAFN
FT                   GAQRWAEETGGSFREIELQSEAQREQALRRFAEAGANPVITMGFAMADPLSAVAADYPD
FT                   TKFVAVDVTWLDAPNIRQIGFAEHEGSYLVGMMAAMASKSGTVGFVGGMDIPLIRHFGC
FT                   GYAQGVKAVNPDVKIVANMTGTTPAAWNDPVKGSELTKAQISQGADVVYAAAGGTGVGV
FT                   LQTAADEGILSIGVDSNQNHLHPGKVLTSMLKRVDVAVYDAMKAGENLETGVFNMGLAE
FT                   EGVGYALDDNNAALISGEMKAAVDQARQDIIDGKLNVVSYYENDSCPALKF"
     MTLMKSLMGA AAAMALTAGA ALAEPALIFD LGGKFDKSFN EAAFNGAQRW AEETGGSFRE        60
     IELQSEAQRE QALRRFAEAG ANPVITMGFA MADPLSAVAA DYPDTKFVAV DVTWLDAPNI       120
     RQIGFAEHEG SYLVGMMAAM ASKSGTVGFV GGMDIPLIRH FGCGYAQGVK AVNPDVKIVA       180
     NMTGTTPAAW NDPVKGSELT KAQISQGADV VYAAAGGTGV GVLQTAADEG ILSIGVDSNQ       240
     NHLHPGKVLT SMLKRVDVAV YDAMKAGENL ETGVFNMGLA EEGVGYALDD NNAALISGEM       300
     KAAVDQARQD IIDGKLNVVS YYENDSCPAL KF                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page