(data stored in ACNUC7421 zone)

EMBL: CP000031.PE371

CP000031.PE371       Location/Qualifiers
FT   CDS             complement(395729..396142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0380"
FT                   /product="ribosomal-protein-alanine acetyltransferase,
FT                   putative"
FT                   /note="identified by similarity to SP:P09453; match to
FT                   protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93698"
FT                   /db_xref="GOA:Q5LXG1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG1"
FT                   /protein_id="AAV93698.1"
FT                   /translation="MTPTELARLHARAFTQSRPWSESEFAALLGNPHTHLVGDLRCFAL
FT                   FQVIAGEAELLTIATDPDQRRQGLARACMDAWQAQAARAGATRALLDVAADNDPAIALY
FT                   TACGYAPCGLRRGYYRRPSGETADAIVMERPLP"
     MTPTELARLH ARAFTQSRPW SESEFAALLG NPHTHLVGDL RCFALFQVIA GEAELLTIAT        60
     DPDQRRQGLA RACMDAWQAQ AARAGATRAL LDVAADNDPA IALYTACGYA PCGLRRGYYR       120
     RPSGETADAI VMERPLP                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page