(data stored in ACNUC7421 zone)

EMBL: CP000031.PE373

CP000031.PE373       Location/Qualifiers
FT   CDS             complement(396719..397282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0382"
FT                   /product="nifU domain protein"
FT                   /note="identified by match to protein family HMM PF01106"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93700"
FT                   /db_xref="GOA:Q5LXH0"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH0"
FT                   /protein_id="AAV93700.1"
FT                   /translation="MFIQTESTPNPATLKFLPGQTVLEVGTADFPSAEAAEKSPLAARI
FT                   FAVSGVTGVFFGNDFVTVTKAEGVEWDHIKPAILGAVMEHYQSGQPVMGADAQTGSGHA
FT                   EHSGEDAEVVTQIKALLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLT
FT                   LKMGIENLLRHYIPEVTEVRPVAV"
     MFIQTESTPN PATLKFLPGQ TVLEVGTADF PSAEAAEKSP LAARIFAVSG VTGVFFGNDF        60
     VTVTKAEGVE WDHIKPAILG AVMEHYQSGQ PVMGADAQTG SGHAEHSGED AEVVTQIKAL       120
     LDSRVRPAVA QDGGDITFHG FDRGVVYLHM QGACAGCPSS TLTLKMGIEN LLRHYIPEVT       180
     EVRPVAV                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page