(data stored in ACNUC9435 zone)

EMBL: CP000031.PE374

CP000031.PE374       Location/Qualifiers
FT   CDS             complement(397406..398020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0383"
FT                   /product="acyl carrier protein phosphodiesterase, putative"
FT                   /note="identified by similarity to SP:P41407; match to
FT                   protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93701"
FT                   /db_xref="GOA:Q5LXG9"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LXG9"
FT                   /protein_id="AAV93701.1"
FT                   /translation="MTKLLQIIASPRGGDSKSNALADAFVAAQRAKDSTLQVDHLDLWA
FT                   EDLPAFDGDPAAAKMTFFGVGQMDPSKEQAWSAVARITERFMSADHVVMGVPMWNGGIP
FT                   YRLKHYIDIITQPGMLFGFDPDNGYSGLLRNRKATVVTTSGVWSEGADARFGSDFHSTY
FT                   LKWWFETIGITDVTFVRYQPSLLTDDPQAGYDRALAALTAA"
     MTKLLQIIAS PRGGDSKSNA LADAFVAAQR AKDSTLQVDH LDLWAEDLPA FDGDPAAAKM        60
     TFFGVGQMDP SKEQAWSAVA RITERFMSAD HVVMGVPMWN GGIPYRLKHY IDIITQPGML       120
     FGFDPDNGYS GLLRNRKATV VTTSGVWSEG ADARFGSDFH STYLKWWFET IGITDVTFVR       180
     YQPSLLTDDP QAGYDRALAA LTAA                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page