(data stored in ACNUC7421 zone)

EMBL: CP000031.PE375

CP000031.PE375       Location/Qualifiers
FT   CDS             398149..398739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0384"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC89223.1; match to
FT                   protein family HMM PF07336"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93702"
FT                   /db_xref="GOA:Q5LXG8"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG8"
FT                   /protein_id="AAV93702.1"
FT                   /translation="MQTALPPPYLIADDPGLELLNSTGAPYGTEIDWLQNGTEMLAWMQ
FT                   AVGLLGATEAELVRSTLGARELDAAASDLRDLRAMFRENVPVASAGFVDRLNACLAETS
FT                   GHARIVMTEAGTQELQHVQRFRTGRDLVGLCALAIAELLSQGESGRTRQCGGPTCTYWF
FT                   RDVSKNNRRRWCSMAVCGNRAKVATHRARARSE"
     MQTALPPPYL IADDPGLELL NSTGAPYGTE IDWLQNGTEM LAWMQAVGLL GATEAELVRS        60
     TLGARELDAA ASDLRDLRAM FRENVPVASA GFVDRLNACL AETSGHARIV MTEAGTQELQ       120
     HVQRFRTGRD LVGLCALAIA ELLSQGESGR TRQCGGPTCT YWFRDVSKNN RRRWCSMAVC       180
     GNRAKVATHR ARARSE                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page