(data stored in ACNUC7421 zone)

EMBL: CP000031.PE376

CP000031.PE376       Location/Qualifiers
FT   CDS             complement(398793..399386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0385"
FT                   /product="2-hydroxychromene-2-carboxylate isomerase,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93703"
FT                   /db_xref="GOA:Q5LXG7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG7"
FT                   /protein_id="AAV93703.1"
FT                   /translation="MGKRIAFWFEFASTYSYLSAMRIERAAADLGVTIAWEPFLLGPIF
FT                   AAQGWTSSPFNLFPAKGRYMWRDMERLCARQGLPLTRPDPFPQNGLPAARLAMVAREMG
FT                   HIAPFVRAVYAAQFGRGLVISDPQVLAECWAEAGLPPEAMEQAKSPEIKAALFAQGERA
FT                   AALDLFGAPSFVVGEEVFWGDDRLDQALALAAQS"
     MGKRIAFWFE FASTYSYLSA MRIERAAADL GVTIAWEPFL LGPIFAAQGW TSSPFNLFPA        60
     KGRYMWRDME RLCARQGLPL TRPDPFPQNG LPAARLAMVA REMGHIAPFV RAVYAAQFGR       120
     GLVISDPQVL AECWAEAGLP PEAMEQAKSP EIKAALFAQG ERAAALDLFG APSFVVGEEV       180
     FWGDDRLDQA LALAAQS                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page