(data stored in ACNUC7421 zone)

EMBL: CP000031.PE378

CP000031.PE378       Location/Qualifiers
FT   CDS             complement(399889..400953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0387"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93705"
FT                   /db_xref="GOA:Q5LXH6"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH6"
FT                   /protein_id="AAV93705.1"
FT                   /translation="MIAQIGDPRRDLLTLAVGALGALIATLVHMPMALLAGPAVAVSLA
FT                   GLCGLSLHISPRLRDAGFLVIGLSIGSLVGPESIEAMMRWPVAFGLLAGLTLATPWAGR
FT                   WLIPRLLPIDRDEAFLAAAPGHLSLVIALADSLQLSLTRPVVLASIRLMALTLLVPLAA
FT                   SLAGIEIGPGLPQLAAVTPWAWILGQIVAALLLAPVLKALKLPAHVLIAGIVVAATTHL
FT                   AGWTAGGLPGWAAQASLILMGAMIGSRFGGMGWRELRQSLTAGLAIVVLTTGLATLAAL
FT                   PAAYLSGLPLLDVLLGFSPGGLETMIILSAALGADPSFVAAAHLFRLSVLAVVLTLYAT
FT                   DVARRGQGKSDGQR"
     MIAQIGDPRR DLLTLAVGAL GALIATLVHM PMALLAGPAV AVSLAGLCGL SLHISPRLRD        60
     AGFLVIGLSI GSLVGPESIE AMMRWPVAFG LLAGLTLATP WAGRWLIPRL LPIDRDEAFL       120
     AAAPGHLSLV IALADSLQLS LTRPVVLASI RLMALTLLVP LAASLAGIEI GPGLPQLAAV       180
     TPWAWILGQI VAALLLAPVL KALKLPAHVL IAGIVVAATT HLAGWTAGGL PGWAAQASLI       240
     LMGAMIGSRF GGMGWRELRQ SLTAGLAIVV LTTGLATLAA LPAAYLSGLP LLDVLLGFSP       300
     GGLETMIILS AALGADPSFV AAAHLFRLSV LAVVLTLYAT DVARRGQGKS DGQR             354
//

If you have problems or comments...

PBIL Back to PBIL home page